Skip to content

Synthyra/FastPLMs

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

493 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

FastPLMs

FastPLMs Hero Image

FastPLMs is an open-source initiative dedicated to making protein language models (pLMs) efficient and easy to use. By replacing native, often suboptimal attention implementations with Flash Attention or Flex Attention, we provide high-performance alternatives that are fully compatible with the HuggingFace transformers ecosystem and can easily be loaded with no extra code with AutoModel.


Table of Contents

  1. Introduction
  2. Documentation
  3. Supported Models
  4. Attention Backends
  5. Embedding & Pooling
  6. Experimental Test-Time Training
  7. Concrete Examples
  8. Testing & Benchmarking
  9. Installation & Docker

Documentation

Detailed documentation is available in the docs/ folder:


Introduction

What are Protein Language Models (pLMs)?

Protein Language Models are transformer-based architectures trained on massive datasets of protein sequences (such as UniProt). These models learn the "grammar" of proteins, capturing evolutionary information, structural constraints, and functional motifs. They are used for:

  • Representation Learning: Generating high-dimensional embeddings for downstream tasks (e.g., stability, function prediction).
  • Protein Generation: Designing novel sequences with specific properties.
  • Structure Prediction: Mapping sequences to their 3D folds (e.g., Boltz2).

What is this repository?

FastPLMs provides optimized versions of these models. Our focus is on:

  • Speed: Drastically faster inference through optimized attention kernels.
  • Memory Efficiency: Lower VRAM usage, enabling larger batch sizes or longer sequences.
  • Seamless Integration: Use AutoModel.from_pretrained(..., trust_remote_code=True) to load our optimized weights directly from HuggingFace.

Supported Models

We maintain a comprehensive HuggingFace Collection of optimized models. Below is a summary of the supported families and their origins.

Model Registry Summary

Model Family Organization Official Implementation FastPLMs Optimization Checkpoints
E1 Profluent Bio Profluent-Bio/E1 Flex Attention, Block-Causal 150M, 300M, 600M
ESM2 Meta AI facebookresearch/esm Flash (SDPA) / Flex Attention 8M, 35M, 150M, 650M, 3B
ESM++ Biohub Biohub/esm Optimized SDPA / Flex Small (300M), Large (600M), 6B
ESM3 Biohub Biohub/esm HF AutoModel wrapper Open Small
ESMFold2 Biohub Biohub/esm Self-contained HF AutoModel wrapper with FastPLMs ESM++ LM backbone, opt-in experimental TTT Full, Fast, Experimental, Cutoff2025
DPLM ByteDance bytedance/dplm Diffusion Optimized Attention 150M, 650M, 3B
DPLM2 ByteDance bytedance/dplm Multimodal Diffusion 150M, 650M, 3B
ANKH Elnaggar Lab ElnaggarLab/ankh T5 RPE via Flex score_mod Base, Large, ANKH2-L, ANKH3-L, ANKH3-XL
ESMFold Meta AI facebookresearch/esm Fast ESM2 backbone, opt-in experimental ProteinTTT Standard
Boltz2 MIT / Various jwohlwend/boltz Optimized Structure Prediction Standard

Full Model List

Model Key Family Parameters Organization FastPLMs Repo ID Official Reference
esm2_8m ESM2 7.5M Meta AI Synthyra/ESM2-8M facebook/esm2_t6_8M_UR50D
esm2_35m ESM2 33.5M Meta AI Synthyra/ESM2-35M facebook/esm2_t12_35M_UR50D
esm2_150m ESM2 148.2M Meta AI Synthyra/ESM2-150M facebook/esm2_t30_150M_UR50D
esm2_650m ESM2 651.1M Meta AI Synthyra/ESM2-650M facebook/esm2_t33_650M_UR50D
esm2_3b ESM2 2.84B Meta AI Synthyra/ESM2-3B facebook/esm2_t36_3B_UR50D
esmplusplus_small ESM++ 333.0M Biohub Synthyra/ESMplusplus_small biohub/ESMC-300M
esmplusplus_large ESM++ 575.0M Biohub Synthyra/ESMplusplus_large biohub/ESMC-600M
esmplusplus_6b ESM++ 6.35B Biohub Synthyra/ESMplusplus_6B biohub/ESMC-6B
esm3_small ESM3 1.4B Biohub Synthyra/ESM3_small biohub/esm3-sm-open-v1
esmfold2 ESMFold2 234.8M + ESM++ 6B Biohub Synthyra/ESMFold2 biohub/ESMFold2
esmfold2_fast ESMFold2 188.8M + ESM++ 6B Biohub Synthyra/ESMFold2-Fast biohub/ESMFold2-Fast
esmfold2_experimental_fast ESMFold2 188.8M + ESM++ 6B Biohub Synthyra/ESMFold2-Experimental-Fast biohub/ESMFold2-Experimental-Fast
esmfold2_experimental_fast_cutoff2025 ESMFold2 188.8M + ESM++ 6B Biohub Synthyra/ESMFold2-Experimental-Fast-Cutoff2025 biohub/ESMFold2-Experimental-Fast-Cutoff2025
esmfold2_experimental ESMFold2 234.8M + ESM++ 6B Biohub Synthyra/ESMFold2-Experimental biohub/ESMFold2-Experimental
esmfold2_experimental_cutoff2025 ESMFold2 234.8M + ESM++ 6B Biohub Synthyra/ESMFold2-Experimental-Cutoff2025 biohub/ESMFold2-Experimental-Cutoff2025
e1_150m E1 154.4M Profluent Bio Synthyra/Profluent-E1-150M Profluent-Bio/E1-150m
e1_300m E1 274.3M Profluent Bio Synthyra/Profluent-E1-300M Profluent-Bio/E1-300m
e1_600m E1 641.4M Profluent Bio Synthyra/Profluent-E1-600M Profluent-Bio/E1-600m
dplm_150m DPLM 148.2M ByteDance Synthyra/DPLM-150M airkingbd/dplm_150m
dplm_650m DPLM 651.1M ByteDance Synthyra/DPLM-650M airkingbd/dplm_650m
dplm_3b DPLM 2.84B ByteDance Synthyra/DPLM-3B airkingbd/dplm_3b
dplm2_150m DPLM2 158.7M ByteDance Synthyra/DPLM2-150M airkingbd/dplm2_150m
dplm2_650m DPLM2 672.1M ByteDance Synthyra/DPLM2-650M airkingbd/dplm2_650m
dplm2_3b DPLM2 2.88B ByteDance Synthyra/DPLM2-3B airkingbd/dplm2_3b
ankh_base ANKH 453.3M Elnaggar Lab Synthyra/ANKH_base ElnaggarLab/ankh-base
ankh_large ANKH 1.15B Elnaggar Lab Synthyra/ANKH_large ElnaggarLab/ankh-large
ankh2_large ANKH 1.15B Elnaggar Lab Synthyra/ANKH2_large ElnaggarLab/ankh2-ext2
ankh3_large ANKH 1.15B Elnaggar Lab Synthyra/ANKH3_large ElnaggarLab/ankh3-large
ankh3_xl ANKH 3.49B Elnaggar Lab Synthyra/ANKH3_xl ElnaggarLab/ankh3-xl
esmfold ESMFold 3.53B Meta AI Synthyra/FastESMFold facebookresearch/esm
boltz2 Boltz2 506.3M MIT / Various Synthyra/Boltz2 jwohlwend/boltz

Experimental Test-Time Training

FastPLMs includes experimental ProteinTTT-style test-time training utilities for sequence PLMs and the PLM backbones used by ESMFold and ESMFold2. TTT is disabled by default. Normal from_pretrained, forward, embed_dataset, fold_protein, and state_dict() behavior is unchanged unless you explicitly call ttt(), fold_protein(..., ttt=True), or fold_protein_ttt().

TTT briefly adapts a model to one input protein using masked language modeling and local LoRA adapters. It can improve predictions for difficult or low-confidence proteins, especially structure predictions with weak baseline pLDDT, but it is not guaranteed to help. It adds GPU memory use and runtime, can degrade already confident predictions, and should be treated as an experimental test-time compute option.

Supported opt-in paths:

Model family TTT API Notes
ESM2, ESM++, ESM3, E1, DPLM, DPLM2, ANKH model.ttt(seq=...) MLM LoRA adaptation of the PLM backbone only
FastESMFold model.fold_protein(sequence, ttt=True) or model.fold_protein_ttt(sequence) Returns the best pLDDT fold across baseline and TTT steps
ESMFold2 model.fold_protein(sequence, ttt=True, ttt_config=...) or model.fold_protein_ttt(sequence) Protein-only v1 path, trains LoRA only on the ESM++ _esmc backbone
Boltz2 Not supported Boltz2 remains inference-only in FastPLMs

Sequence PLM example:

from transformers import AutoModelForMaskedLM

model = AutoModelForMaskedLM.from_pretrained(
    "Synthyra/ESM2-8M",
    trust_remote_code=True,
).cuda().eval()

# No adapters are injected until this call.
metrics = model.ttt(
    seq="MSTNPKPQRKTKRNT",
    ttt_config={"steps": 3, "ags": 1, "batch_size": 1},
)
model.ttt_reset()

ESMFold2 example:

from transformers import AutoModel

model = AutoModel.from_pretrained(
    "Synthyra/ESMFold2-Fast",
    trust_remote_code=True,
    load_esmc=True,
    esmc_attn_backend="flex",
).cuda().eval()

result = model.fold_protein(
    "MSTNPKPQRKTKRNT",
    num_loops=1,
    num_sampling_steps=10,
    ttt=True,
    ttt_config={"steps": 1, "ags": 1, "batch_size": 1},
)
print(result.ttt_metrics)

ESMFold2 loads Synthyra/ESMplusplus_6B as its LM backbone by default. Legacy biohub/ESMC-* IDs in older configs are accepted as migration aliases and normalized to the matching Synthyra ESM++ checkpoint. For FP8 LM inference, pass esmc_precision="fp8" and install transformer_engine.pytorch in a CUDA environment with FP8-capable hardware. FP8 is inference-only, so TTT remains a bf16/fp32 path.

If you use the TTT functionality, cite ProteinTTT in addition to FastPLMs and the underlying model papers. The ProteinTTT citation is listed in Citations.


License Notes

Biohub ESM++ and ESM3 model cards include license: mit metadata and upload a LICENSE file copied from the Biohub ESM MIT license. The upstream license is linked from each model card and from the source repository at https://github.com/Biohub/esm/blob/main/LICENSE.md.


Attention Backends

All FastPLMs models share a common set of attention backends, controlled via config.attn_backend. The default is "sdpa", which is safe on all hardware and numerically equivalent to standard attention.

Backend Comparison

Backend Key Speed Numerical Equivalence Availability
PyTorch SDPA "sdpa" Fast Exact Any PyTorch ≥ 2.0
Flash Attention "kernels_flash" Fastest Approximate Requires pip install kernels (pre-built)
Flex Attention "flex" Very fast ~Exact Requires PyTorch ≥ 2.11 (FA4 backend on Hopper/Blackwell)
Auto "auto" Always (selects best available)

SDPA (default)

PyTorch's scaled_dot_product_attention dispatches to a fused CUDA kernel (cuDNN or efficient attention) that is faster and more memory-efficient than naive attention, while being mathematically identical to it. This is the recommended default for reproducibility and general use. It is also the only backend where output_attentions=True is handled natively; with other backends, attentions are computed via a separate naive matrix multiplication when requested.

Flash Attention (kernels_flash)

Flash Attention 2 and 3 are typically the fastest options on Ampere (A100) and Hopper (H100) GPUs, often 2–4× faster than SDPA at long sequence lengths. Flash Attention achieves this by tiling the computation and applying an online softmax, which means the results are not bitwise identical to SDPA or naive attention. Differences are on the order of floating-point rounding and are often inconsequential for standard inference — but they are not guaranteed to be so. They can compound across layers, interact with low-precision dtypes (fp16/bf16), or affect sensitive downstream tasks. Flash Attention is standard practice in large model training and the trade-off is well understood, but it should not be treated as a drop-in numerical equivalent of SDPA. If exact reproducibility or numerical sensitivity is a concern, use "sdpa" instead.

No compilation required. FastPLMs uses the HuggingFace kernels package to load pre-built Flash Attention 2/3 binaries at runtime — no C++ compiler, no CUDA toolkit version pinning, no waiting:

pip install kernels

Building flash-attn from source is notoriously painful. The Ninja build system parallelizes aggressively across all available CPU cores, and each NVCC/CICC compiler process it spawns can consume 5–8 GB of RAM on its own. On a 64-core machine this can push peak RAM usage to ~300 GB, and even on a throttled single-threaded build (MAX_JOBS=1 NVCC_THREADS=1) the compile still takes many hours while grinding through paging. Pre-built community wheels cover 384+ version/GPU/CUDA/platform combinations and still routinely fall short of matching a user's exact environment. This is the point where most people give up and go without Flash Attention entirely. The kernels package sidesteps all of this by fetching a pre-compiled binary matched to your GPU architecture (SM80 for Ampere, SM90 for Hopper). If no compatible binary exists for your hardware, it gracefully falls back to flex or sdpa rather than erroring.

Flex Attention (flex)

PyTorch's flex_attention (PyTorch >= 2.11 in FastPLMs Docker images) generates a fused Triton kernel customized to the mask pattern at hand. It is numerically very close to SDPA, typically within floating-point rounding of naive computation. The primary advantage is that it can apply a block mask that skips padding tokens entirely, providing a meaningful speedup on batches with variable-length sequences (no compute wasted on padding). E1 uses a block-causal variant of this mask.

The first forward pass triggers JIT compilation via Triton, which can take 30–120 seconds. All subsequent calls are fast. Combining with torch.compile yields the best sustained throughput.

Auto (auto)

Automatically selects the best available backend in order of preference: kernels_flashflexsdpa. Useful when you want maximum speed without configuring the environment manually, and you accept that the resolved backend may differ across machines.

Setting the Backend

At load time (every family):

from transformers import AutoConfig, AutoModel

config = AutoConfig.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True)
config.attn_backend = "flex"  # "sdpa", "kernels_flash", "flex", or "auto"
model = AutoModel.from_pretrained("Synthyra/ESM2-150M", config=config, trust_remote_code=True)

After load time (every family):

Every family's PreTrainedModel subclass exposes a mutable attn_backend property whose setter propagates the change to every attention submodule in-place, so you can swap backends on a loaded model without reloading the weights:

model = AutoModel.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True)
model.attn_backend = "flex"           # every attention layer now uses flex
model.attn_backend = "kernels_flash"  # flip again, no reload

This is handy for benchmarking backends on the same weights or for falling back at runtime if a backend is unavailable. The setter asserts if the requested backend isn't installed on the current GPU (e.g. kernels_flash without the kernels package).

Returning Attention Maps

All backends support output_attentions=True. For the optimized backends (SDPA, Flash Attention, Flex), attention weights are computed via a separate naive matrix multiplication and appended to the output — so enabling this negates the memory savings of those backends. Use it only for inspection or contact prediction, not during high-throughput inference.


Embedding & Pooling

The EmbeddingMixin (shared across all models) provides a standardized way to extract representations from proteins.

The Pooler

The Pooler class aggregates sequence-level residue representations into a single fixed-size vector. Supported strategies include:

  • mean: Mask-aware average of all residues.
  • cls: The first token's representation (Standard for classification).
  • max: Element-wise maximum across the sequence.
  • var / std: Variance or Standard Deviation of representations.
  • norm: L2 normalization.
  • median: Element-wise median.
  • parti: Experimental PageRank-based attention pooling.

Concrete Examples

1. Batch Embedding with SQLite (Scalable)

Ideal for embedding millions of sequences where you need to stream data or avoid OOM on RAM.

import torch
from transformers import AutoModel

model = AutoModel.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True).cuda()

sequences = ["MALWMRLLPLLALLALWGPDPAAA", "MKTIIALSYIFCLVFA", ...]

# Embed and store in SQLite
model.embed_dataset(
    sequences=sequences,
    batch_size=64,
    pooling_types=['mean', 'cls'], # Concatenates both
    sql=True,
    sql_db_path='large_protein_db.db',
    embed_dtype=torch.float32
)

2. Embedding from a FASTA File

Pass a FASTA file path directly — no manual parsing required. Multi-line sequences are handled automatically. You can combine fasta_path with an explicit sequences list and the two sources are merged before embedding.

# Embed all sequences in a FASTA file and save to SQLite
model.embed_dataset(
    fasta_path='my_proteins.fasta',
    batch_size=64,
    pooling_types=['mean'],
    sql=True,
    sql_db_path='my_proteins.db',
)

# Mix a FASTA file with an explicit list
model.embed_dataset(
    sequences=["MKTIIALSYIFCLVFA"],
    fasta_path='additional_proteins.fasta',
    batch_size=32,
    save=True,
    save_path='combined_embeddings.pth',
)

3. High-Throughput In-Memory Embedding

Perfect for medium-sized datasets that fit in memory.

# Embed and return as a dictionary
embeddings = model.embed_dataset(
    sequences=sequences,
    batch_size=128,
    pooling_types=['mean'],
    save=True,
    save_path='my_embeddings.pth'
)

# Access embedding
seq_vector = embeddings["MALWMRLLPLLALLALWGPDPAAA"] # torch.Tensor

4. Custom Pooling & Multi-Strategy

Concatenate multiple mathematical representations for richer downstream features.

# Use a variety of pooling types
embeddings = model.embed_dataset(
    sequences=sequences,
    pooling_types=['mean', 'max', 'std', 'var'], # All 4 concatenated
    batch_size=32,
    full_embeddings=False
)

# Resulting vector size: 4 * hidden_size
print(embeddings[sequences[0]].shape)

5. FastPLMs Binder Design With ESMFold2 And ESM++

FastPLMs includes a binder design workflow that mirrors the Biohub ESMFold2 tutorial while using only FastPLMs model repos. ESMFold2 experimental checkpoints provide differentiable folding losses and final critics, while ESM++ provides the masked-LM pseudoperplexity regularizer.

FastPLMs EGFR minibinder design

Run the verified EGFR 128 amino acid de novo minibinder example on a CUDA workstation with the ESMFold2 Docker image:

cd /home/ubuntu/FastPLMs

sudo -n docker run --gpus all --rm \
  -v /home/ubuntu/FastPLMs:/app \
  -v /home/ubuntu/FastPLMs:/workspace \
  -v /home/ubuntu/.cache/huggingface:/workspace/.cache/huggingface \
  -w /workspace fastplms-esmfold2 \
  python /app/cookbook/tutorials/binder_design_fastplms.py \
    --backend local \
    --target-name egfr \
    --binder-sequence '################################################################################################################################' \
    --not-antibody \
    --steps 150 \
    --batch-size 1 \
    --seed 103 \
    --output-dir /workspace/campaign_egfr_len128_b1_s150_seed103_consensus_cli

The run writes trajectory.jsonl, best_sequences.fasta, results.parquet, selection.parquet, and per-critic PDB/CIF/logit files. The verified result had hero mean iPTM 0.913870, hero min iPTM 0.904600, and all four hero ESMFold2 critics above 0.9.

Binder sequence:

SAVKHLLEIVKYLEEAIEKALEVDPVFLVPPAAEELLIAAKVIKELAKENPELIEVYELLMKAVKGLKKLVRSNDKEILREVIRLLRKAAKVIREILKNNPDLDPELRKALEELAKVLEEIAEVLEQQ

See docs/binder_design.md for the full strategy, official selection rule, Modal backend, per-critic metrics, and caveats.


Testing & Benchmarking

FastPLMs includes a pytest-based test suite under testing/ covering correctness, compliance, and performance. All GPU tests run inside Docker. See docs/testing.md for the full guide.

Test Categories

Test What it checks Marker
AutoModel loading Every model loads via the relevant Transformers auto class with trust_remote_code=True and produces valid outputs gpu
Backend consistency SDPA, Flex, and Flash backends produce equivalent predictions (>= 95% agreement) gpu
Weight compliance FastPLM weights are bit-exact with the original implementations (ESM2, ESMC, ESM3, E1, DPLM) slow, gpu
Forward compliance Forward pass logits/predictions match the originals within tolerance slow, gpu
Rigorous parity Per-layer fp32 + bf16 hidden-state and last_hidden_state parity, padding-isolation, tokenizer parity, embed_dataset pipeline parity. Run per family in its own Docker image. gpu
NaN stability Batched inference with padding produces no NaN in real-token embeddings gpu
Batch-single match Batch and single-item embedding produce identical results gpu
Full model suite All of the above across every checkpoint (8M through 3B) gpu, large
Throughput benchmark Tokens/sec across models, backends, batch sizes, and sequence lengths slow, gpu
Structure models Boltz2, ESMFold, and ESMFold2 loading + forward/parity checks structure, slow, gpu

Running Tests with Docker

FastPLMs uses a per-family Docker setup. A single shared base image (fastplms-base) holds torch + transformers + the FastPLMs source, and one image per model family (fastplms-esm2, fastplms-esm_plusplus, fastplms-esm3, fastplms-esmfold2, fastplms-e1, fastplms-dplm, fastplms-dplm2, fastplms-ankh) layers on top with that family's native reference package. This isolates conflicting dependencies (e.g. Biohub esm vs fair-esm, DPLM's torchtext pin) and keeps each image small.

# Initialize submodules (required before building Docker)
git submodule update --init --recursive

# Build base + every family image
./build_images.sh

# Build a single family
./build_images.sh esm2
./build_images.sh esm_plusplus
./build_images.sh esm3
./build_images.sh esmfold2

Run the parity / compliance tests for one family inside its image:

# ESM2
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esm2 \
    python -m pytest /workspace/testing/test_parity.py -k esm2 -v

# ESM++ (model_key is "esmc")
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esm_plusplus \
    python -m pytest /workspace/testing/test_parity.py -k esmc -v

# ESM3, requires accepted access to biohub/esm3-sm-open-v1 for official parity
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esm3 \
    python -m pytest /workspace/testing/test_parity.py -k esm3 -v

# ESMFold2 / ESMFold2-Fast
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esmfold2 \
    python -m pytest /workspace/testing/test_esmfold2.py -v -s

# E1, DPLM, DPLM2, ANKH
for fam in e1 dplm dplm2 ankh; do
    docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-$fam \
        python -m pytest /workspace/testing/test_parity.py -k $fam -v
done

The legacy monolithic Dockerfile (image tag fastplms) is still supported for the broader test suites that don't need native package isolation:

docker build -t fastplms .

# Fast tests (small models, no compliance, no structure)
docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -m "gpu and not slow and not large and not structure" -v

# All sequence model tests except 3B
docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -m "not large and not structure" -v

# Full suite including 3B models (requires 40+ GB VRAM)
docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -m "not structure" -v

# Structure models only (Boltz2, ESMFold, ESMFold2)
docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -m "structure" -v

On Windows, replace $(pwd) with ${PWD}. Always pass --ipc=host with PyTorch.

Compliance / Native Reference Dependencies

The parity and compliance tests compare FastPLM outputs against the original model implementations. Each per-family Docker image installs only the deps it needs; outside Docker you can install them piecewise:

Dependency Used by Install
cloudpathlib, zstd, biotite (+ official/esm submodule on sys.path) ESM++ / ESMC, ESM3 official parity provided by Dockerfile.esm_plusplus and Dockerfile.esm3; the Biohub esm package itself is not pip-installed because it depends on a Biohub transformers fork.
Biohub transformers fork, rdkit, biotite, msgpack-numpy, pydssp, pygtrie, py3dmol ESMFold2 parity and structure export; runtime LM loading uses FastPLMs ESM++ provided by Dockerfile.esmfold2
E1 E1 pip install -e official/e1 (or use Dockerfile.e1)
transformers (EsmForMaskedLM, T5EncoderModel) ESM2, DPLM, ANKH already in requirements.txt

If a native dep is missing in your environment, the corresponding parity tests are skipped rather than failing.

Throughput Benchmarks

Throughput can be measured via the pytest test (saves structured JSON/CSV/PNG results) or the standalone script (more configurable).

# Pytest (benchmarks ESM2-8M, ESMplusplus_small, DPLM-150M, DPLM2-150M across all backends)
docker run --gpus all -v $(pwd):/workspace fastplms python -m pytest /app/testing/test_throughput.py -v -s
# Output: throughput_results.json, throughput_results.csv, throughput_comparison.png

# Standalone (fully configurable)
docker run --gpus all -v $(pwd):/workspace fastplms \
    python -m testing.throughput \
    --model_paths Synthyra/ESM2-8M Synthyra/ESMplusplus_small \
    --backends sdpa flex kernels_flash \
    --batch_sizes 2 4 8 \
    --sequence_lengths 64 128 256 512 1024 2048 \
    --output_path /workspace/throughput_comparison.png

Installation & Docker

Local Installation

FastPLMs is developed and tested with Python 3.12 and CUDA 12.8. For local GPU installs, install the cu128 PyTorch wheels first, then the pinned direct dependencies:

git clone --recurse-submodules https://github.com/Synthyra/FastPLMs.git
cd FastPLMs
python -m pip install --upgrade pip==26.1.1 setuptools==70.2.0
python -m pip install torch==2.11.0 torchvision==0.26.0 --index-url https://download.pytorch.org/whl/cu128
python -m pip install -r requirements.txt

If you already cloned without --recurse-submodules, initialize submodules separately:

git submodule update --init --recursive

Docker (Recommended for GPU Testing)

There are two Docker layouts; pick whichever matches your task.

Per-family layout (recommended for parity / compliance work). A shared base image plus one image per model family, each with that family's native reference package isolated from the others. Build all of them once with the helper script:

git submodule update --init --recursive
./build_images.sh                       # base + every family
./build_images.sh esm2 esm_plusplus     # subset

This produces fastplms-base and fastplms-{esm2,esm_plusplus,esm3,e1,dplm,dplm2,ankh}. Run a family's tests in its image:

docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esm2 \
    python -m pytest /workspace/testing/test_parity.py -k esm2 -v

docker run --rm --gpus all --ipc=host -v $(pwd):/workspace -it fastplms-esm2 bash

Monolithic layout (legacy, single image). The original Dockerfile bundles every dependency that can coexist in one image. Convenient for the broad test suites and throughput benchmarks; not suitable when two families' native deps conflict (notably Biohub esm vs fair-esm).

git submodule update --init --recursive
docker build -t fastplms .

docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -v
docker run --gpus all --ipc=host -v $(pwd):/workspace -it fastplms bash

On Windows, replace $(pwd) with ${PWD}. Always pass --ipc=host with PyTorch.


Suggestions & Contributions

Found a bug or have a feature request? Please open a GitHub Issue. We are actively looking for contributions to optimize more pLM architectures!


Citations

If you use FastPLMs, please cite the following along with the relevant model paper(s).

FastPLMs

@misc{FastPLMs,
  author={Hallee, Logan and Bichara, David and Gleghorn, Jason P.},
  title={FastPLMs: Fast, efficient, protein language model inference from Huggingface AutoModel.},
  year={2024},
  url={https://huggingface.co/Synthyra/ESMplusplus_small},
  DOI={10.57967/hf/3726},
  publisher={Hugging Face}
}

Flex Attention

@article{dong2024flexattention,
  title={Flex Attention: A Programming Model for Generating Optimized Attention Kernels},
  author={Dong, Juechu and Feng, Boyuan and Guessous, Driss and Liang, Yanbo and He, Horace},
  journal={arXiv preprint arXiv:2412.05496},
  year={2024}
}

PyTorch

@inproceedings{paszke2019pytorch,
  title={PyTorch: An Imperative Style, High-Performance Deep Learning Library},
  author={Paszke, Adam and Gross, Sam and Massa, Francisco and Lerer, Adam and Bradbury, James and Chanan, Gregory and Killeen, Trevor and Lin, Zeming and Gimelshein, Natalia and Antiga, Luca and Desmaison, Alban and K{\"o}pf, Andreas and Yang, Edward and DeVito, Zach and Raison, Martin and Tejani, Alykhan and Chilamkurthy, Sasank and Steiner, Benoit and Fang, Lu and Bai, Junjie and Chintala, Soumith},
  booktitle={Advances in Neural Information Processing Systems 32},
  year={2019}
}

ESM2

@article{lin2023esm2,
  title={Evolutionary-scale prediction of atomic-level protein structure with a language model},
  author={Lin, Zeming and Akin, Halil and Rao, Roshan and Hie, Brian and Zhu, Zhongkai and Lu, Wenting and Smestad, Nikita and Verkuil, Robert and Kabeli, Ori and Shmueli, Yaniv and dos Santos Costa, Allan and Fazel-Zarandi, Maryam and Sercu, Tom and Candido, Salvatore and Rives, Alexander},
  journal={Science},
  volume={379},
  number={6637},
  pages={1123--1130},
  year={2023},
  DOI={10.1126/science.ade2574}
}

ESM++ (ESMC)

@misc{candido2026language,
  title  = {Language Modeling Materializes a World Model of Protein Biology},
  author = {Candido, Salvatore and Hayes, Thomas and Derry, Alexander and Rao, Roshan
            and Lin, Zeming and Verkuil, Robert and Wu, Bryan and Lee, Jin Sub
            and Bruguera, Elise S. and Keval, Jehan A. and Kopylov, Mykhailo
            and Pak, John E. and Wu, Wesley and Thomas, Neil and Mataraso, Samson
            and Hsu, Alvin and Trotman-Grant, Ashton C. and Fatras, Kilian
            and dos Santos Costa, Allan and Badkundri, Rohil and Ak{\i}n, Halil
            and Oktay, Deniz and Deaton, Jonathan and Montabana, Elizabeth
            and Sitwala, Hrishita and Yu, Yue and Wiggert, Marius
            and Carlin, Dylan Alexander and Goering, Anthony W. and Blazejewski, Tomasz
            and Sandora, McCullen and Hla, Michael and Jia, Tina Z.
            and Kloker, Leon H. and Sofroniew, Nicholas J. and Uehara, Masatoshi
            and Pannu, Jassi and Bachas, Sharrol and Liu, Daniel S.
            and Sercu, Tom and Rives, Alexander},
  year   = {2026},
  url    = {https://biohub.ai/papers/esm_protein.pdf},
  note   = {Preprint}
}

E1

@article{jain2025e1,
  title={E1: Retrieval-Augmented Protein Encoder Models},
  author={Jain, Sarthak and Beazer, Joel and Ruffolo, Jeffrey A and Bhatnagar, Aadyot and Madani, Ali},
  journal={bioRxiv},
  DOI={10.1101/2025.11.12.688125},
  year={2025}
}

DPLM

@article{wang2024dplm,
  title={Diffusion Language Models Are Versatile Protein Learners},
  author={Wang, Xinyou and Ye, Zaixiang and Huang, Fei and Cao, Dongyan and Liang, Shujian and Huang, Liang},
  journal={Proceedings of the 41st International Conference on Machine Learning},
  year={2024}
}

DPLM2

@article{wang2024dplm2,
  title={DPLM-2: A Multimodal Diffusion Protein Language Model},
  author={Wang, Xinyou and Ye, Zaixiang and Huang, Fei and Cao, Dongyan and Liang, Shujian and Huang, Liang},
  journal={arXiv preprint arXiv:2410.13782},
  year={2024}
}

ANKH

@article{elnaggar2023ankh,
  title={Ankh: Optimized Protein Language Model Unlocks General-Purpose Modelling},
  author={Elnaggar, Ahmed and Essam, Hazem and Salah-Eldin, Wafaa and Moustafa, Walid and Elkerdawy, Mohamed and Rochereau, Charlotte and Rost, Burkhard},
  journal={arXiv preprint arXiv:2301.06568},
  year={2023}
}
@article{alsamkary2025ankh3,
  title={Ankh3: Multi-Task Pretraining with Sequence Denoising and Completion Enhances Protein Representations},
  author={Alsamkary, Hazem and Elshaffei, Mohamed and Elkerdawy, Mohamed and Elnaggar, Ahmed},
  journal={arXiv preprint arXiv:2505.20052},
  year={2025}
}

Boltz

@article{passaro2025boltz2,
  title={Boltz-2: Exploring the Frontiers of Biomolecular Prediction},
  author={Passaro, Saro and Corso, Gabriele and Wohlwend, Jeremy and Reveiz, Mateo and Bordes, Florian and Wicky, Basile and Dayan, Peter and Jing, Bowen},
  journal={bioRxiv},
  year={2025}
}
@article{wohlwend2024boltz1,
  title={Boltz-1: Democratizing Biomolecular Interaction Modeling},
  author={Wohlwend, Jeremy and Corso, Gabriele and Passaro, Saro and Reveiz, Mateo and Leidal, Ken and Swanson, Wojtek and Kher, Gilmer and Lember, Tommi and Jaakkola, Tommi},
  journal={bioRxiv},
  year={2024}
}

ESMFold / ProteinTTT

@misc{bushuiev2026proteinneed,
  title={One protein is all you need},
  author={Anton Bushuiev and Roman Bushuiev and Olga Pimenova and Nikola Zadorozhny and Raman Samusevich and Elisabet Manaskova and Rachel Seongeun Kim and Hannes St\"ark and Jiri Sedlar and Martin Steinegger and Tom\'a\v{s} Pluskal and Josef Sivic},
  year={2026},
  eprint={2411.02109},
  archivePrefix={arXiv},
  primaryClass={cs.LG},
  url={https://arxiv.org/abs/2411.02109}
}

About

Easy to use and efficient implementations of Protein Language Models

Resources

License

Contributing

Stars

48 stars

Watchers

2 watching

Forks

Releases

No releases published

Packages

 
 
 

Contributors

Languages